PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01490A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 445aa    MW: 49204.4 Da    PI: 8.7189
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01490AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.8e-144589147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT++E++l+++  +++G   W++I +++g  +t+ q++s+ qk+
  Oropetium_20150105_01490A 45 REKWTEDEHKLFLESLQLHGRA-WRRIQEHIG-SKTAVQIRSHAQKF 89
                               789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-143994IPR009057Homeodomain-like
PROSITE profilePS5129417.8464094IPR017930Myb domain
TIGRFAMsTIGR015571.9E-144392IPR006447Myb domain, plants
SMARTSM007178.4E-124492IPR001005SANT/Myb domain
PfamPF002492.6E-124588IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-84585IPR009057Homeodomain-like
CDDcd001675.70E-94790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MAHFKEFEVR NGQRAGAGAG VAAMNLPAEK RVPKARKPYT ISKQREKWTE DEHKLFLESL  60
QLHGRAWRRI QEHIGSKTAV QIRSHAQKFF SKVTRESSAD GNALAAAPQI RIPPPRPKKK  120
PAYPYPRKLG NHSPAKDAPS LKQLHKPQPQ LRVVRSSYEQ ENCSPKSVLT VAQIGSETPA  180
SDSVRSPASS VDVEVSCHAP KVTAVEVTND KTVSENVMCG IPESPVLRLF GERVVVNHLH  240
HEPKSTAEKE QNVADMELDE STETPTSRTA KLSSHSAAEA NTLSPWQNNT NQYMYYLPRG  300
KVLFVPSDCQ FFSYNNGSIA CNMLDLDQQG KKQQRHQPSQ AADCRFTSGE GSCSESITTA  360
SGMPETPTQN SDSVESIQVT NNKEEEMVLP GPRKCVSPTP DCLRGFVPYK KCTAESKIIQ  420
FPALGEEADR EMTRLCLYSS RPHS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976600.11e-169PREDICTED: myb-like protein J
TrEMBLK3Y7861e-169K3Y786_SETIT; Uncharacterized protein
STRINGSi010077m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.17e-32MYB_related family protein